About lab
Guided Boltz-2 workflow for exploring a malaria-related falcipain-2 target with an E-64 reference inhibitor-like ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.
Runtime
Duration0.01
Comms Step0.01
Settle Steps1
Runs
Total0
Completed0
Failed0
Metadata
Packageboltz-malaria-binding-workflow
Created2026-05-23
Updated2026-06-13
boltz-workflowboltzprotein-ligandaffinitystructural-biologyguided-workflowgpumalariainfectious-diseasefalcipain-2contextprovenanceinput-assemblyinterpretationdockingvisualisationother
Manifest
{
"io": {
"inputs": [
{
"ui": {
"rows": 6,
"control": "textarea"
},
"name": "protein_sequence",
"label": "Falcipain-2 Sequence",
"format": "sequence",
"maps_to": "falcipain_ligand_setup.protein_sequence",
"required": false,
"value_type": "string",
"description": "Amino-acid sequence for the curated Plasmodium falciparum falcipain-2 target; maps directly to the Boltz-2 protein input."
},
{
"ui": {
"rows": 3,
"control": "textarea"
},
"name": "ligand_smiles",
"label": "E-64 Ligand SMILES",
"format": "smiles",
"maps_to": "falcipain_ligand_setup.ligand_smiles",
"required": false,
"value_type": "string",
"description": "SMILES string for the E-64 reference cysteine-protease inhibitor example; maps directly to the Boltz-2 ligand input."
},
{
"ui": {
"control": "file"
},
"file": {
"accept": [
".a3m",
".fasta",
".fa"
]
},
"name": "msa_path",
"label": "Precomputed MSA Path",
"format": "a3m",
"maps_to": "falcipain_ligand_setup.msa_path",
"required": false,
"value_type": "file",
"description": "Optional path to a precomputed MSA file; leave unset when the configured Boltz MSA server is used."
},
{
"name": "use_msa_server",
"label": "Use MSA Server",
"default": true,
"maps_to": "falcipain_ligand_setup.run_options.use_msa_server",
"value_type": "boolean",
"description": "Use Boltz's MSA server instead of requiring a precomputed MSA file."
},
{
"name": "sampling_steps",
"label": "Sampling Steps",
"default": 200,
"maps_to": "falcipain_ligand_setup.run_options.sampling_steps",
"value_type": "integer",
"description": "Number of Boltz sampling steps for structure generation."
},
{
"name": "recycling_steps",
"label": "Recycling Steps",
"default": 3,
"maps_to": "falcipain_ligand_setup.run_options.recycling_steps",
"value_type": "integer",
"description": "Number of structure recycling steps."
},
{
"name": "diffusion_samples",
"label": "Diffusion Samples",
"default": 1,
"maps_to": "falcipain_ligand_setup.run_options.diffusion_samples",
"value_type": "integer",
"description": "Number of Boltz diffusion samples to generate."
},
{
"name": "output_format",
"label": "Output Format",
"default": "mmcif",
"maps_to": "falcipain_ligand_setup.run_options.output_format",
"value_type": "string",
"description": "Structure artifact format emitted by Boltz.",
"allowed_values": [
"mmcif",
"pdb"
]
},
{
"ui": {
"rows": 6,
"control": "json"
},
"name": "run_options",
"label": "Boltz Run Options",
"format": "json",
"maps_to": "falcipain_ligand_setup.run_options",
"advanced": true,
"required": false,
"value_type": "record",
"description": "Optional structured controls for the Boltz workflow, including source metadata, sampling settings, and interpretation scope."
}
],
"outputs": [
{
"name": "scenario_context",
"label": "Workflow Scenario Context",
"maps_to": "malaria_target_context.scenario_context",
"description": "Source-backed target, ligand, use-case, provenance, and caveat context for this Boltz workflow."
},
{
"name": "assembled_boltz_request",
"label": "Assembled Boltz Request",
"maps_to": "falcipain_ligand_setup.assembled_boltz_request",
"description": "Traceable summary of the protein, ligand, MSA, and run options prepared for Boltz."
},
{
"name": "affinity_summary",
"label": "Affinity-Style Summary",
"maps_to": "boltz_boltz2_affinity_predictor.affinity_summary",
"description": "Parsed Boltz-2 binder probability and affinity-like outputs for this falcipain-ligand prediction."
},
{
"name": "confidence_summary",
"label": "Structure Confidence Summary",
"maps_to": "boltz_boltz2_affinity_predictor.confidence_summary",
"description": "Parsed Boltz-2 confidence outputs for the predicted falcipain-ligand complex."
},
{
"name": "structure_artifacts",
"label": "Predicted Complex Structure Artifacts",
"maps_to": "boltz_boltz2_affinity_predictor.structure_artifacts",
"description": "File-backed predicted complex structures used by the 3D visualisation."
},
{
"name": "run_metadata",
"label": "Boltz Run Metadata",
"maps_to": "boltz_boltz2_affinity_predictor.run_metadata",
"description": "Runtime status, command metadata, logs, and caveats for the latest Boltz invocation."
},
{
"name": "prediction_evidence",
"label": "Conservative Prediction Evidence",
"maps_to": "malaria_prediction_interpreter.prediction_evidence",
"description": "Interpreted Boltz output evidence with request traceability and explicit scientific caveats."
}
]
},
"tags": [
"boltz-workflow",
"boltz",
"protein-ligand",
"affinity",
"structural-biology",
"guided-workflow",
"gpu",
"malaria",
"infectious-disease",
"falcipain-2"
],
"title": "Boltz Workflow: Malaria Binding",
"models": [
{
"path": "models/context",
"alias": "malaria_target_context",
"parameters": {
"scenario": {
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"source_pdb": "3BPF",
"ligand_name": "E-64 reference cysteine-protease inhibitor",
"ligand_role": "reference cysteine-protease inhibitor",
"target_name": "Plasmodium falciparum falcipain-2 cysteine protease",
"disease_area": "malaria target exploration",
"target_family": "falcipain-2 cysteine protease",
"workflow_name": "Malaria Binding Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Plasmodium falciparum falcipain-2 cysteine protease and E-64 reference cysteine-protease inhibitor",
"workflow_question": "What does Boltz-2 predict for this malaria-related protease and reference inhibitor-like ligand?",
"source_pubchem_cid": "123985",
"interpretation_scope": "Learning and early hypothesis generation only",
"protein_sequence_length": 241
},
"integration_step": 0.01
}
},
{
"path": "models/input_assembler",
"alias": "falcipain_ligand_setup",
"parameters": {
"workflow_kind": "single",
"workflow_name": "Malaria Binding Workflow",
"integration_step": 0.01,
"default_run_options": {
"source_pdb": "3BPF",
"ligand_name": "E-64 reference cysteine-protease inhibitor",
"target_name": "Plasmodium falciparum falcipain-2 cysteine protease",
"workflow_name": "Malaria Binding Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Plasmodium falciparum falcipain-2 cysteine protease and E-64 reference cysteine-protease inhibitor",
"source_pubchem_cid": "123985",
"interpretation_scope": "Learning and early hypothesis generation only"
},
"default_ligand_smiles": "CC(C)C[C@@H](C(=O)NCCCCN=C(N)N)NC(=O)[C@@H]1[C@H](O1)C(=O)O",
"default_protein_sequence": "QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE"
}
},
{
"path": "models/core",
"alias": "boltz_boltz2_affinity_predictor",
"parameters": {
"override": true,
"accelerator": "gpu",
"runtime_mode": "managed",
"output_format": "mmcif",
"sampling_steps": 200,
"use_msa_server": true,
"recycling_steps": 3,
"diffusion_samples": 1
}
},
{
"path": "models/interpreter",
"alias": "malaria_prediction_interpreter",
"parameters": {
"mode": "single",
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"core_alias": "boltz_boltz2_affinity_predictor",
"workflow_name": "Malaria Binding Workflow",
"integration_step": 0.01
}
},
{
"path": "models/visualisation",
"alias": "visualisation",
"parameters": {
"mode": "boltz",
"lab_title": "Boltz Workflow: Malaria Binding",
"source_alias": "boltz_boltz2_affinity_predictor",
"context_alias": "malaria_target_context",
"assembler_alias": "falcipain_ligand_setup",
"integration_step": 0.01,
"interpreter_alias": "malaria_prediction_interpreter"
}
}
],
"wiring": [
{
"to": [
"falcipain_ligand_setup.scenario_context",
"malaria_prediction_interpreter.scenario_context",
"visualisation.malaria_target_context_scenario_context"
],
"from": "malaria_target_context.scenario_context"
},
{
"to": [
"boltz_boltz2_affinity_predictor.protein_sequence"
],
"from": "falcipain_ligand_setup.protein_sequence"
},
{
"to": [
"boltz_boltz2_affinity_predictor.ligand_smiles"
],
"from": "falcipain_ligand_setup.ligand_smiles"
},
{
"to": [
"boltz_boltz2_affinity_predictor.msa_path"
],
"from": "falcipain_ligand_setup.msa_path"
},
{
"to": [
"boltz_boltz2_affinity_predictor.run_options"
],
"from": "falcipain_ligand_setup.run_options"
},
{
"to": [
"malaria_prediction_interpreter.assembled_boltz_request",
"visualisation.falcipain_ligand_setup_assembled_boltz_request"
],
"from": "falcipain_ligand_setup.assembled_boltz_request"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_affinity_summary",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_affinity_summary"
],
"from": "boltz_boltz2_affinity_predictor.affinity_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_confidence_summary",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_confidence_summary"
],
"from": "boltz_boltz2_affinity_predictor.confidence_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_structure_artifacts",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_structure_artifacts"
],
"from": "boltz_boltz2_affinity_predictor.structure_artifacts"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_run_metadata",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_run_metadata"
],
"from": "boltz_boltz2_affinity_predictor.run_metadata"
},
{
"to": [
"visualisation.malaria_prediction_interpreter_prediction_evidence"
],
"from": "malaria_prediction_interpreter.prediction_evidence"
}
],
"package": "boltz-malaria-binding-workflow",
"runtime": {
"duration": 0.01,
"settle_steps": 1,
"initial_inputs": {},
"python_version": "3.10",
"communication_step": 0.01
},
"version": "1.0.0",
"description": "Guided Boltz-2 workflow for exploring a malaria-related falcipain-2 target with an E-64 reference inhibitor-like ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.",
"schema_version": "2.0"
}Sign in to start your own run. Public-lab history stays visible here.
Select a run from History to view its results.